Recombinant Chicken TNNI2 protein, Avi-tagged, Biotinylated
Cat.No. : | TNNI2-4784C |
Product Overview : | Biotinylated Recombinant Chicken TNNI2 protein(P68246)(2-183 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | Avi |
Protein Length : | 2-183 aa |
Conjugation/Label : | Biotin |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | SDEEKKRRAATARRQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEHCPPLSLPGSMQEL QELCKKLHAKIDSVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLRRVRMSADA MLRALLGSKHKVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAG ES |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
TNNI2-1996H | Recombinant Human TNNI2 protein | +Inquiry |
TNNI2-17H | Recombinant Human TNNI2, GST-tagged | +Inquiry |
TNNI2-6968C | Recombinant Chicken TNNI2 | +Inquiry |
TNNI2-5865R | Recombinant Rat TNNI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNNI2-16H | Recombinant Human TNNI2, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNI2-1802HCL | Recombinant Human TNNI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNI2 Products
Required fields are marked with *
My Review for All TNNI2 Products
Required fields are marked with *
0
Inquiry Basket