Recombinant Chicken VAMP7 Protein (2-181 aa), His-tagged

Cat.No. : VAMP7-2330C
Product Overview : Recombinant Chicken VAMP7 Protein (2-181 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : E.coli
Tag : His
Protein Length : 2-181 aa
Description : Involved in the targeting and/or fusion of transport vesicles to their target mbrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.3 kDa
AA Sequence : AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIIYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKYHSESKGTDQVAETQAQVDELKGIMVRNIDLVAQRGEKLELLIDKTENLVDSSVTFKTTSRNLARA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name VAMP7 vesicle associated membrane protein 7 [ Gallus gallus (chicken) ]
Official Symbol VAMP7
Synonyms VAMP7; SYBL1;
Gene ID 422297
mRNA Refseq NM_001031121
Protein Refseq NP_001026292
UniProt ID Q5ZL74

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VAMP7 Products

Required fields are marked with *

My Review for All VAMP7 Products

Required fields are marked with *

0
cart-icon