Recombinant Ciona Intestinalis RPS13 Protein (2-151 aa), His-Myc-tagged
| Cat.No. : | RPS13-2577C |
| Product Overview : | Recombinant Ciona Intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13 Protein (2-151 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Ciona Intestinalis |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-151 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 23.9 kDa |
| AA Sequence : | GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | rps13 rs13 protein [ Ciona intestinalis (vase tunicate) ] |
| Official Symbol | RPS13 |
| Synonyms | RPS13; rs13; |
| Gene ID | 445688 |
| mRNA Refseq | NM_001032506 |
| Protein Refseq | NP_001027678 |
| UniProt ID | Q8I7D6 |
| ◆ Recombinant Proteins | ||
| RPS13-2415H | Recombinant Human RPS13, GST-tagged | +Inquiry |
| RPS13-4808R | Recombinant Rat RPS13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPS13-14468M | Recombinant Mouse RPS13 Protein | +Inquiry |
| RPS13-4012R | Recombinant Rhesus monkey RPS13 Protein, His-tagged | +Inquiry |
| RPS13-564H | Recombinant Human ribosomal protein S13, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPS13-558HCL | Recombinant Human RPS13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS13 Products
Required fields are marked with *
My Review for All RPS13 Products
Required fields are marked with *
