Recombinant Ciona Intestinalis RPS13 Protein (2-151 aa), His-Myc-tagged

Cat.No. : RPS13-2577C
Product Overview : Recombinant Ciona Intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13 Protein (2-151 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Ciona Intestinalis
Source : E.coli
Tag : His&Myc
Protein Length : 2-151 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 23.9 kDa
AA Sequence : GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name rps13 rs13 protein [ Ciona intestinalis (vase tunicate) ]
Official Symbol RPS13
Synonyms RPS13; rs13;
Gene ID 445688
mRNA Refseq NM_001032506
Protein Refseq NP_001027678
UniProt ID Q8I7D6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS13 Products

Required fields are marked with *

My Review for All RPS13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon