Recombinant COVID-19 NSP9 protein, His-tagged
Cat.No. : | NSP9-029V |
Product Overview : | Recombinant COVID-19 NSP9 protein(YP_009742616.1)(1-113aa) was fused to His-tagged at C-terminus and expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sars-CoV-2 |
Source : | E.coli |
Tag : | His |
Protein Length : | Full length |
Description : | Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies. |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ORF1ab |
Official Symbol | ORF1ab |
Synonyms | Non-structural protein 9 |
Gene ID | 43740578 |
Protein Refseq | YP_009742616.1 |
UniProt ID | P0DTD1 |
◆ Recombinant Proteins | ||
Plpro-11V | Active Recombinant COVID-19 Plpro protein | +Inquiry |
ORF1ab-392S | Recombinant SARS-CoV-2 ORF1ab Protein, His-tagged | +Inquiry |
ORF1ab-184S | Recombinant SARS-CoV-2 ORF1ab Protein, His-tagged | +Inquiry |
ORF1ab-02S | Recombinant SARS-CoV-2 ORF1ab Protein, MBP-tagged | +Inquiry |
NSP9-028V | Recombinant COVID-19 NSP9 protein, hFC/Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF1ab Products
Required fields are marked with *
My Review for All ORF1ab Products
Required fields are marked with *
0
Inquiry Basket