Recombinant Cricetulus Griseus GLUL Protein (2-373 aa), His-SUMO-tagged
Cat.No. : | GLUL-2062C |
Product Overview : | Recombinant Cricetulus Griseus (Chinese hamster) (Cricetulus barabensis griseus) GLUL Protein (2-373 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus Griseus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-373 aa |
Description : | Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 58.2 kDa |
AA Sequence : | ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRHRYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGVADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAVTEAIVRTCLLNETGDQPFQYKN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | GLUL; GS Glutamate decarboxylase Glutamate--ammonia ligase; |
UniProt ID | P04773 |
◆ Recombinant Proteins | ||
GLUL-153H | Recombinant Human GLUL Protein, His-tagged | +Inquiry |
GLUL-2653H | Recombinant Human GLUL Protein (Met1-Asn507), N-His tagged | +Inquiry |
GLUL-2147HFL | Recombinant Full Length Human GLUL Protein, C-Flag-tagged | +Inquiry |
GLUL-1702R | Recombinant Rhesus Macaque GLUL Protein, His (Fc)-Avi-tagged | +Inquiry |
GLUL-553C | Recombinant Cynomolgus GLUL Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLUL-5890HCL | Recombinant Human GLUL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLUL Products
Required fields are marked with *
My Review for All GLUL Products
Required fields are marked with *
0
Inquiry Basket