Recombinant Cynomolgus monkey CD3E Protein, His-tagged
Cat.No. : | CD3E-139C |
Product Overview : | Recombinant Cynomolgus monkey CD3E protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Protein Length : | 198 |
Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
Form : | Lyophilized |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); T-cell surface glycoprotein CD3 epsilon chain; |
Gene ID | 699467 |
mRNA Refseq | XM_015115816 |
Protein Refseq | XP_014971302 |
UniProt ID | G7NCB9 |
◆ Recombinant Proteins | ||
CD3E-139C | Recombinant Cynomolgus monkey CD3E Protein, His-tagged | +Inquiry |
CD3E & CD3G-3257M | Recombinant Mouse CD3E & CD3G protein(Met1-Asp108 & Met1-Ser116), hFc&His&hFc-tagged | +Inquiry |
CD3E-1055C | Recombinant Canine CD3E Protein, Fc-tagged | +Inquiry |
RFL22526HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain(Cd3E) Protein, His-Tagged | +Inquiry |
CD3E-143H | Recombinant Human CD3E Protein, Strep-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
0
Inquiry Basket