Recombinant Cynomolgus monkey GLP1R protein, His-tagged
Cat.No. : | GLP1R-4649C |
Product Overview : | Recombinant Cynomolgus monkey GLP1R protein(F8V479)(24-144 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus monkey |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-144 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 16.1 kDa |
AASequence : | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
GLP1R-1934H | Recombinant Human GLP1R Transmembrane protein, His&Flag-tagged(Nanodisc) | +Inquiry |
RFL22237HF | Recombinant Full Length Human Glucagon-Like Peptide 1 Receptor(Glp1R) Protein, His-Tagged | +Inquiry |
GLP1R-2205H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
GLP1R-294C | Recombinant Cynomolgus Monkey GLP1R Protein, His (Fc)-Avi-tagged | +Inquiry |
Glp1r-8060M | Recombinant Mouse Glp1r protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *