Recombinant Cynomolgus monkey LY6G6D protein, His-tagged
Cat.No. : | LY6G6D-4633C |
Product Overview : | Recombinant Cynomolgus monkey LY6G6D protein(UJY53414.1)(20-104aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-104aa |
Tag : | N-His |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL. |
Molecular Mass : | 11.1 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS |
◆ Recombinant Proteins | ||
LY6G6D-4633C | Recombinant Cynomolgus monkey LY6G6D protein, His-tagged | +Inquiry |
LY6G6D-3165R | Recombinant Rat LY6G6D Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6G6D-9182H | Recombinant Human LY6G6D Protein(10-104aa), His-tagged | +Inquiry |
LY6G6D-3509R | Recombinant Rat LY6G6D Protein | +Inquiry |
Ly6g6d-4533M | Recombinant Mouse Ly6g6d protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6G6D-4599HCL | Recombinant Human LY6G6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6G6D Products
Required fields are marked with *
My Review for All LY6G6D Products
Required fields are marked with *
0
Inquiry Basket