| Species : |
Cynomolgus |
| Source : |
Yeast |
| Tag : |
His |
| Protein Length : |
20-104aa |
| Tag : |
N-His |
| Form : |
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : |
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL. |
| Molecular Mass : |
11.1 kDa |
| Endotoxin : |
Less than 1.0 EU/ug as determined by LAL method. |
| Purity : |
Greater than 95% as determined by SDS-PAGE. |
| Storage : |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : |
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS |