Recombinant Dengue flavivirus polyprotein gene protein

Cat.No. : flavivirus polyprotein gene-40D
Product Overview : The E.Coli derived recombinant protein contains the NS1 Dengue Virus c-end Type-2 immunodominant regions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : DENV
Source : E.coli
Tag : Non
Description : Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
Form : 20mM Tris-HCl pH 8.0, 8M urea & 60mM NaCl.
AA sequence : LWSNGVLESEMVIPKNFAGPKSQHNNRPGYHTQTAGPWHLGKLEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKEKEENLVSSLVTAHHHHHH
Purity : Dengue Protein is >90% pure as determined by 10% PAGE (coomassie staining).
Applications : Each laboratory should determine an optimum working titer for use in its particular application.
Usage : The products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Storage : Dengue although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Shipping : Ice Packs
Gene Name flavivirus polyprotein gene flavivirus polyprotein [ Dengue virus 2 ]
Official Symbol flavivirus polyprotein gene
Synonyms flavivirus polyprotein gene; flavivirus polyprotein; anchored capsid protein C; capsid protein C; membrane glycoprotein precursor M; membrane glycoprotein M; envelope protein E; nonstructural protein NS1; nonstructural protein NS2A; nonstructural protein NS2B; nonstructural protein NS3; nonstructural protein NS4A; protein 2K; nonstructural protein NS4B; RNA-dependent RNA polymerase NS5; protein pr
Gene ID 1494449
Protein Refseq NP_056776.2
UniProt ID A0A173DS53

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All flavivirus polyprotein gene Products

Required fields are marked with *

My Review for All flavivirus polyprotein gene Products

Required fields are marked with *

0
cart-icon