Recombinant Dictyostelium Discoideum PONA Protein (23-118 aa), His-tagged
Cat.No. : | PONA-2070D |
Product Overview : | Recombinant Dictyostelium Discoideum (Slime mold) PONA Protein (23-118 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-118 aa |
Description : | Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.9 kDa |
AA Sequence : | QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | ponA; |
UniProt ID | P54660 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PONA Products
Required fields are marked with *
My Review for All PONA Products
Required fields are marked with *