Recombinant Dog CCL17 protein(24-99aa), MBP&His-Avi-tagged, Biotinylated

• Cat.No.: CCL17-6432D
• Product Overview: Biotinylated Recombinant Dog CCL17 protein(Q95N01)(24-99aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: Avi&His&MBP
• Protein Length: 24-99aa
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES
• Conjugation: Biotin

Gene Information

• Gene Name: CCL17 chemokine (C-C motif) ligand 17 [ Canis lupus familiaris ]
• Official Symbol: CCL17
• Synonyms: CCL17; chemokine (C-C motif) ligand 17; C-C motif chemokine 17; CC chemokine TARC; small-inducible cytokine A17; thymus and activation-regulated chemokine; TARC
• Gene ID: 403586
• mRNA Refseq: NM_001003051
• Protein Refseq: NP_001003051