Recombinant Dog IL8 Protein (23-101 aa), GST-tagged

Cat.No. : IL8-579D
Product Overview : Recombinant Dog IL8 Protein (23-101 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : GST
Protein Length : 23-101 aa
Description : IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 36.1 kDa
AA Sequence : AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name IL8 interleukin 8 [ Canis lupus familiaris ]
Official Symbol IL8
Synonyms IL8; interleukin 8; interleukin-8; IL-8;
Gene ID 403850
mRNA Refseq NM_001003200
Protein Refseq NP_001003200
UniProt ID P41324

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL8 Products

Required fields are marked with *

My Review for All IL8 Products

Required fields are marked with *

0
cart-icon