Recombinant Dog IL8 Protein (23-101 aa), GST-tagged

• Cat.No.: IL8-579D
• Product Overview: Recombinant Dog IL8 Protein (23-101 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Dog
• Source: E.coli
• Tag: GST
• Protein Length: 23-101 aa
• Description: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 36.1 kDa
• AA Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: IL8 interleukin 8 [ Canis lupus familiaris ]
• Official Symbol: IL8
• Synonyms: IL8; interleukin 8; interleukin-8; IL-8
• Gene ID: 403850
• mRNA Refseq: NM_001003200
• Protein Refseq: NP_001003200
• UniProt ID: P41324