Recombinant Dog LHB protein, His-tagged
| Cat.No. : | LHB-3173D |
| Product Overview : | Recombinant Dog LHB protein(P18842)(18-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-138aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.8 kDa |
| AA Sequence : | SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | LHB luteinizing hormone beta polypeptide [ Canis lupus familiaris ] |
| Official Symbol | LHB |
| Synonyms | LHB; luteinizing hormone beta polypeptide; lutropin subunit beta; LSH-beta; lutropin beta chain; luteinizing hormone subunit beta; LH; LH-B; LSH-B; |
| Gene ID | 403959 |
| mRNA Refseq | NM_001197033 |
| Protein Refseq | NP_001183962 |
| ◆ Recombinant Proteins | ||
| LHB-3173D | Recombinant Dog LHB protein, His-tagged | +Inquiry |
| LHB-652C | Recombinant Cynomolgus LHB Protein, His-tagged | +Inquiry |
| LHB-1511H | Recombinant Human LHB Protein, MYC/DDK-tagged | +Inquiry |
| LHB-398C | Recombinant Cynomolgus Monkey LHB Protein, His (Fc)-Avi-tagged | +Inquiry |
| LHB-1091H | Recombinant Human LHB Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
| LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LHB-1522HCL | Recombinant Human LHB Overexpression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHB Products
Required fields are marked with *
My Review for All LHB Products
Required fields are marked with *



