Recombinant Dog MB protein, His-tagged
Cat.No. : | MB-745D |
Product Overview : | Recombinant Dog MB protein(P63113)(2-154aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-154a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG |
Gene Name | MB myoglobin [ Canis lupus familiaris ] |
Official Symbol | MB |
Synonyms | MB; myoglobin; |
Gene ID | 608715 |
◆ Recombinant Proteins | ||
MB-2424H | Recombinant Human MB Protein, His-tagged | +Inquiry |
MB-745D | Recombinant Dog MB protein, His-tagged | +Inquiry |
MB-1056H | Recombinant Human Myoglobin Protein | +Inquiry |
MB-1768H | Recombinant Human MB Protein, His&GST-tagged | +Inquiry |
MB-10864Z | Recombinant Zebrafish MB | +Inquiry |
◆ Native Proteins | ||
Mb-160M | Native Mouse Mb | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
MB-30275TH | Native Human MB | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *