Recombinant Dog MB protein, His-tagged
| Cat.No. : | MB-745D |
| Product Overview : | Recombinant Dog MB protein(P63113)(2-154aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-154a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG |
| Gene Name | MB myoglobin [ Canis lupus familiaris ] |
| Official Symbol | MB |
| Synonyms | MB; myoglobin; |
| Gene ID | 608715 |
| ◆ Recombinant Proteins | ||
| MB-2165W | Recombinant Sperm Whale Myoglobin | +Inquiry |
| MB-1056H | Recombinant Human Myoglobin Protein | +Inquiry |
| Mb-3977M | Recombinant Mouse Mb Protein, Myc/DDK-tagged | +Inquiry |
| MB-01H | Recombinant Human MB Protein, His-tagged | +Inquiry |
| MB-2680S | Recombinant Sheep MB protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MB-8227H | Native Human Heart Myoglobin | +Inquiry |
| Mb-160M | Native Mouse Mb | +Inquiry |
| MB-4460H | Native Human Myoglobin | +Inquiry |
| MB-02B | Native Bovine MB Protein | +Inquiry |
| MB-30275TH | Native Human MB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
| MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
