Recombinant E. coli Beta-lactamase CTX-M-1 Protein, His-tagged
Cat.No. : | bla-1146E |
Product Overview : | Recombinant E. coli (strain K12) Beta-lactamase CTX-M-1 Protein (P28585, 29-291 aa) was expressed in E. coli with N-terminal 6xHis tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 29-291 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRV EIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRT EPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKT GSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CTX-M-1 Beta-lactamase, CTX-M-1 [ Escherichia coli ] |
Official Symbol | bla |
Synonyms | Beta-lactamase, CTX-M-1; CTX-M-1; bla; Beta-lactamase |
Gene ID | 20467196 |
Protein Refseq | YP_009061062.1 |
UniProt ID | P28585 |
◆ Native Proteins | ||
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All bla Products
Required fields are marked with *
My Review for All bla Products
Required fields are marked with *