Recombinant E. coli Beta-lactamase CTX-M-1 Protein, His-tagged
| Cat.No. : | bla-1146E |
| Product Overview : | Recombinant E. coli (strain K12) Beta-lactamase CTX-M-1 Protein (P28585, 29-291 aa) was expressed in E. coli with N-terminal 6xHis tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-291 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 32.3 kDa |
| AA Sequence : | QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRV EIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRT EPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKT GSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CTX-M-1 Beta-lactamase, CTX-M-1 [ Escherichia coli ] |
| Official Symbol | bla |
| Synonyms | Beta-lactamase, CTX-M-1; CTX-M-1; bla; Beta-lactamase |
| Gene ID | 20467196 |
| Protein Refseq | YP_009061062.1 |
| UniProt ID | P28585 |
| ◆ Recombinant Proteins | ||
| bla-5673E | Recombinant Escherichia coli bla protein, His-tagged | +Inquiry |
| bla-5637E | Recombinant Escherichia coli bla protein, His-tagged | +Inquiry |
| bla-021S | Recombinant Salmonella typhimurium bla protein, His-tagged | +Inquiry |
| BLA-1085K | Recombinant Klebsiella oxytoca BLA protein(25-293aa) | +Inquiry |
| bla-022S | Recombinant Salmonella typhimurium bla protein | +Inquiry |
| ◆ Native Proteins | ||
| BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All bla Products
Required fields are marked with *
My Review for All bla Products
Required fields are marked with *
