Recombinant E.coli speA protein, His-tagged

• Cat.No.: speA-325
• Product Overview: Recombinant E.coli speA protein fused with His tag was expressed in E. coli.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Description: Biosynthetic arginine decarboxylase played an important role in many functions. Catalyzes the biosynthesis of agmatine from arginine.
• Form: PBS, pH 7.4, 50% glycerol
• Molecular Mass: 76kD
• AA Sequence: DDMSMGLPSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVCPDPDVPEARVDLAQLV KTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAG SKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRAR LASQGSGKWQSSGGEKSKFGLAATQVLQLVETL
• Purity: >90% by SDS-PAGE
• Storage: Store at -20 centigrade, or for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: speA biosynthetic arginine decarboxylase, PLP-binding [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: speA
• Synonyms: ECK2933; JW2905; biosynthetic arginine decarboxylase, PLP-binding; biosynthetic arginine decarboxylase
• Gene ID: 947432
• Protein Refseq: NP_417413
• UniProt ID: P21170
• Pathway: Arginine and proline metabolism, organism-specific biosystem; L-arginine degradation III (arginine decarboxylase/agmatinase pathway), organism-specific biosystem; superpathway of arginine and polyamine biosynthesis, conserved biosystem