Recombinant E. coli yebF Protein, His/MYC-tagged

Cat.No. : yebF-1052E
Product Overview : Recombinant E. coli yebF Protein (22-118aa) was expressed in E. coli with N-terminal His and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&Myc
Protein Length : 22-118 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 15.8 kDa
AA Sequence : ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPL
TVRGKSADIHYQVSVDCKAGMAEYQRR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name yebF extracellular Colicin M immunity family protein [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol yebF
Synonyms ECK1848; JW1836
Gene ID 946363
Protein Refseq NP_416361.2
UniProt ID P33219

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All yebF Products

Required fields are marked with *

My Review for All yebF Products

Required fields are marked with *

0
cart-icon