Recombinant Enterobacteria Phage H19B STXB Protein (21-89 aa), His-SUMO-tagged
| Cat.No. : | STXB-858E |
| Product Overview : | Recombinant Enterobacteria Phage H19B STXB Protein (21-89 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Enterobacteria Phage H19B |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-89 aa |
| Description : | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| UniProt ID | P69179 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXB Products
Required fields are marked with *
My Review for All STXB Products
Required fields are marked with *
