Recombinant Enterobacteria Phage H19B STXB Protein (21-89 aa), His-SUMO-tagged

Cat.No. : STXB-858E
Product Overview : Recombinant Enterobacteria Phage H19B STXB Protein (21-89 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Enterobacteria Phage H19B
Source : E.coli
Tag : His&SUMO
Protein Length : 21-89 aa
Description : The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 23.7 kDa
AA Sequence : TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
UniProt ID P69179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STXB Products

Required fields are marked with *

My Review for All STXB Products

Required fields are marked with *

0
cart-icon