Recombinant Enterobacteria Phage H19B STXB Protein (21-89 aa), His-tagged
Cat.No. : | STXB-1559E |
Product Overview : | Recombinant Enterobacteria Phage H19B (Bacteriophage H19B) STXB Protein (21-89 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria Phage H19B |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-89 aa |
Description : | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 9.7 kDa |
AA Sequence : | TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | stxB; Verocytotoxin 1 subunit B; Verotoxin 1 subunit B; |
UniProt ID | P69179 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXB Products
Required fields are marked with *
My Review for All STXB Products
Required fields are marked with *