Recombinant Enterobacteria phage T4 uvsY Protein, His-SUMO-tagged
| Cat.No. : | uvsY-1397H |
| Product Overview : | Recombinant Enterobacteria phage T4 uvsY Protein (1-137aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Enterobacteria phage T4 |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-137 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 31.8 kDa |
| AA Sequence : | MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDG DEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | uvsY recombination protein; facilitates UvsX and inhibitor of EndoVII [ Enterobacteria phage T4 ] |
| Official Symbol | uvsY |
| Synonyms | fdsB; uvsY |
| Gene ID | 1258547 |
| Protein Refseq | NP_049799.2 |
| UniProt ID | P04537 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All uvsY Products
Required fields are marked with *
My Review for All uvsY Products
Required fields are marked with *
