Recombinant Epstein-Barr virus LMP1 protein, His-tagged
Cat.No. : | LMP1-01E |
Product Overview : | Recombinant Human Epstein-Barr virus LMP1(185-366aa) with His tag was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV4 |
Source : | Yeast |
Tag : | His |
Protein Length : | 185-366 a.a. |
Form : | Tris-based buffer, 50% glycerol |
AA Sequence : | YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGA PGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSA GNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
Purity : | >85% (SDS-PAGE) |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | LMP1 LMP1 [ Human herpesvirus 4 ] |
Official Symbol | LMP1 |
Synonyms | LMP1; Latent membrane protein 1 |
Gene ID | 3783750 |
MIM | P03230 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMP1 Products
Required fields are marked with *
My Review for All LMP1 Products
Required fields are marked with *