Recombinant Escherichia coli ACPP Protein (1-78 aa), His-SUMO-tagged
| Cat.No. : | ACPP-2262E |
| Product Overview : | Recombinant Escherichia coli ACPP Protein (1-78 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-78 aa |
| Description : | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.6 kDa |
| AA Sequence : | MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | acpP acyl carrier protein [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | ACPP |
| Synonyms | acpP; ECK1080; |
| Gene ID | 944805 |
| Protein Refseq | NP_415612 |
| UniProt ID | P0A6A8 |
| ◆ Recombinant Proteins | ||
| ACPP-680S | Recombinant Staphylococcus Aureus ACPP Protein (1-77 aa), GST-tagged | +Inquiry |
| ACPP-146H | Recombinant Human ACPP Protein, His-tagged | +Inquiry |
| ACPP-2924S | Recombinant Staphylococcus epidermidis ATCC 12228 ACPP protein, His-tagged | +Inquiry |
| acpP-5478S | Recombinant Staph acpP protein, GST-tagged | +Inquiry |
| Acpp-002M | Active Recombinant Mouse Acpp Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ACPP-29981TH | Native Human ACPP | +Inquiry |
| PAP-01H | Active Native Human PAP | +Inquiry |
| ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
| ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
| ACPP-1880HCL | Recombinant Human ACPP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACPP Products
Required fields are marked with *
My Review for All ACPP Products
Required fields are marked with *
