Recombinant Escherichia coli ADK Protein (1-214 aa), His-tagged

Cat.No.: ADK-1290E
Product Overview: Recombinant Escherichia coli (strain K12) ADK Protein (1-214 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
Description: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Source: E. coli
Species: E. coli
Tag : His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 27.6 kDa
Protein length: 1-214 aa
AA Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name: adk adenylate kinase [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol: ADK
Synonyms: dnaW; ECK0468; plsA;
Gene ID: 945097
Protein Refseq: NP_415007.1
UniProt ID: P69441

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.