Recombinant Escherichia coli cueO Protein, His-tagged
| Cat.No. : | cueO-20E |
| Product Overview : | Recombinant Escherichia coli cueO Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Description : | CueO multicopper oxidase is a copper-stimulated phenoloxidase and ferroxidase that plays a role in copper homeostasis during aerobiosis . |
| Form : | Supplied as a 0.2 μm filtered solution in PBS, pH8.0. |
| Molecular Mass : | ~58.7KDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTV |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.28mg/ml |
| Gene Name | cueO multicopper oxidase CueO [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | cueO |
| Synonyms | ECK0122; yacK |
| Gene ID | 947736 |
| Protein Refseq | NP_414665 |
| UniProt ID | P36649 |
| ◆ Recombinant Proteins | ||
| cueO-20E | Recombinant Escherichia coli cueO Protein, His-tagged | +Inquiry |
| cueO-643E | Recombinant Escherichia coli O157:H7 cueO protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cueO Products
Required fields are marked with *
My Review for All cueO Products
Required fields are marked with *



