Recombinant Escherichia coli cueO Protein, His-tagged

Cat.No. : cueO-20E
Product Overview : Recombinant Escherichia coli cueO Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Description : CueO multicopper oxidase is a copper-stimulated phenoloxidase and ferroxidase that plays a role in copper homeostasis during aerobiosis .
Form : Supplied as a 0.2 μm filtered solution in PBS, pH8.0.
Molecular Mass : ~58.7KDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTV
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.28mg/ml
Gene Name cueO multicopper oxidase CueO [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol cueO
Synonyms ECK0122; yacK
Gene ID 947736
Protein Refseq NP_414665
UniProt ID P36649

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All cueO Products

Required fields are marked with *

My Review for All cueO Products

Required fields are marked with *

0
cart-icon
0
compare icon