Recombinant Escherichia coli DAPA Protein (1-292 aa), His-tagged
Cat.No. : | DAPA-1313E |
Product Overview : | Recombinant Escherichia coli (strain K12) DAPA Protein (1-292 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-292 aa |
Description : | Catalyzes the condensation of (S)-aspartate-beta-sialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.3 kDa |
AA Sequence : | MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | dapA 4-hydroxy-tetrahydrodipicolinate synthase [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | DAPA |
Synonyms | ECK2474; |
Gene ID | 946952 |
Protein Refseq | NP_416973 |
UniProt ID | P0A6L2 |
◆ Recombinant Proteins | ||
DAPA-1415B | Recombinant Bacillus subtilis DAPA protein, His-tagged | +Inquiry |
DAPA-1040S | Recombinant Streptomyces coelicolor A3(2) DAPA protein, His-tagged | +Inquiry |
DAPA-3152S | Recombinant Staphylococcus epidermidis ATCC 12228 DAPA protein, His-tagged | +Inquiry |
DAPA-1313E | Recombinant Escherichia coli DAPA Protein (1-292 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAPA Products
Required fields are marked with *
My Review for All DAPA Products
Required fields are marked with *
0
Inquiry Basket