Recombinant Escherichia coli DAPA Protein (1-292 aa), His-tagged
| Cat.No. : | DAPA-1313E |
| Product Overview : | Recombinant Escherichia coli (strain K12) DAPA Protein (1-292 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-292 aa |
| Description : | Catalyzes the condensation of (S)-aspartate-beta-sialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 35.3 kDa |
| AA Sequence : | MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | dapA 4-hydroxy-tetrahydrodipicolinate synthase [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | DAPA |
| Synonyms | ECK2474; |
| Gene ID | 946952 |
| Protein Refseq | NP_416973 |
| UniProt ID | P0A6L2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAPA Products
Required fields are marked with *
My Review for All DAPA Products
Required fields are marked with *




