Recombinant Escherichia coli fimH Protein, His-tagged
| Cat.No. : | fimH-23E |
| Product Overview : | Recombinant Escherichia coli fimH Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Description : | Mutants of FimH have been isolated that auto-aggregate. Type 1, or mannose-sensitive, fimbriae in Escherichia coli mediate binding to receptor structures allowing the bacteria to colonize various host tissues. |
| Form : | PBS, pH 7.4 |
| Molecular Mass : | 29 kDa |
| AA Sequence : | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.4 mg/ml |
| Gene Name | fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | fimH |
| Synonyms | ECK4311; pilE |
| Gene ID | 948847 |
| Protein Refseq | NP_418740 |
| UniProt ID | P08191 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fimH Products
Required fields are marked with *
My Review for All fimH Products
Required fields are marked with *
