Recombinant Escherichia coli fimH Protein, His-tagged
Cat.No. : | fimH-23E |
Product Overview : | Recombinant Escherichia coli fimH Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Description : | Mutants of FimH have been isolated that auto-aggregate. Type 1, or mannose-sensitive, fimbriae in Escherichia coli mediate binding to receptor structures allowing the bacteria to colonize various host tissues. |
Form : | PBS, pH 7.4 |
Molecular Mass : | 29 kDa |
AA Sequence : | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.4 mg/ml |
Gene Name | fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | fimH |
Synonyms | ECK4311; pilE |
Gene ID | 948847 |
Protein Refseq | NP_418740 |
UniProt ID | P08191 |
◆ Recombinant Proteins | ||
fimH-6755E | Recombinant Escherichia coli (strain K12) fimH protein, His-tagged | +Inquiry |
FIMH-958E | Recombinant Escherichia coli FIMH Protein (22-300 aa), His-GST-tagged | +Inquiry |
fimH-23E | Recombinant Escherichia coli fimH Protein, His-tagged | +Inquiry |
FIMH-2102E | Recombinant Escherichia coli FIMH Protein (22-300 aa) | +Inquiry |
fimH-16E | Recombinant E. coli fimH Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fimH Products
Required fields are marked with *
My Review for All fimH Products
Required fields are marked with *