Recombinant Escherichia coli fimH Protein, His-tagged

Cat.No. : fimH-23E
Product Overview : Recombinant Escherichia coli fimH Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Description : Mutants of FimH have been isolated that auto-aggregate. Type 1, or mannose-sensitive, fimbriae in Escherichia coli mediate binding to receptor structures allowing the bacteria to colonize various host tissues.
Form : PBS, pH 7.4
Molecular Mass : 29 kDa
AA Sequence : FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.4 mg/ml
Gene Name fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol fimH
Synonyms ECK4311; pilE
Gene ID 948847
Protein Refseq NP_418740
UniProt ID P08191

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All fimH Products

Required fields are marked with *

My Review for All fimH Products

Required fields are marked with *

0
cart-icon