Recombinant Escherichia coli O157:H7 TSX protein, His-tagged
Cat.No. : | TSX-1753E |
Product Overview : | Recombinant Escherichia coli O157:H7 TSX protein(P0A928)(23-294aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-294aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF |
◆ Recombinant Proteins | ||
TSX-6334R | Recombinant Rat TSX Protein | +Inquiry |
TSX-9707M | Recombinant Mouse TSX Protein, His (Fc)-Avi-tagged | +Inquiry |
TSX-17539M | Recombinant Mouse TSX Protein | +Inquiry |
TSX-5990R | Recombinant Rat TSX Protein, His (Fc)-Avi-tagged | +Inquiry |
tsx-753E | Recombinant Escherichia coli (strain K12) tsx protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSX Products
Required fields are marked with *
My Review for All TSX Products
Required fields are marked with *
0
Inquiry Basket