Recombinant Escherichia coli RPSM Protein (30S) (2-118 aa), GST-tagged

• Cat.No.: RPSM-1233E
• Product Overview: Recombinant Escherichia coli (strain K12) RPSM Protein (30S) (2-118 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: GST
• Protein Length: 2-118 aa
• Description: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.0 kDa
• AA Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: rpsM 30S ribosomal subunit protein S13 [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: RPSM
• Synonyms: ECK3285
• Gene ID: 947791
• Protein Refseq: NP_417757
• UniProt ID: P0A7S9