Recombinant Escherichia coli YJBL Protein (1-84 aa), His-KSI-tagged

• Cat.No.: YJBL-2618E
• Product Overview: Recombinant Escherichia coli (strain K12) YJBL Protein (1-84 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-KSI tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&KSI
• Protein Length: 1-84 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.1 kDa
• AA Sequence: MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: yjbL uncharacterized protein YjbL [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: YJBL
• Synonyms: yjbL; ECK4039
• Gene ID: 948551
• Protein Refseq: NP_418471
• UniProt ID: P32693