Recombinant Full Length Aeromonas Hydrophila Subsp. Hydrophila Atp Synthase Subunit A(Atpb) Protein, His-Tagged
| Cat.No. : | RFL27293AF |
| Product Overview : | Recombinant Full Length Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a(atpB) Protein (A0KQY4) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Aeromonas Hydrophila |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-260) |
| Form : | Lyophilized powder |
| AA Sequence : | MSATGEVLTPQGYISHHLTHLQVGSGFWTVNIDSMIFSVLLGALFIWSFRRVAVKATSGV PGKLQCFVEMLVEFVSGNVKDIFHGRNKVIAPLGLTVFVWIFLMNLMDLIPVDFIPHAAQ LMGVPYLRVVPSADVNITMSMALGVFFLILYYSIKVKGIGGFVKELTLQPFNHPAAIPVN LILETVTLISKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILSVPWAIFHILIITLQ AFIFMVLTIVYLSMAQEDHG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | atpB |
| Synonyms | atpB; AHA_4268; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6 |
| UniProt ID | A0KQY4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All atpB Products
Required fields are marked with *
My Review for All atpB Products
Required fields are marked with *
