Recombinant Full Length Anas Platyrhynchos Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged
| Cat.No. : | RFL19200AF |
| Product Overview : | Recombinant Full Length Anas platyrhynchos Estradiol 17-beta-dehydrogenase 12(HSD17B12) Protein (O57314) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Anas platyrhynchos (Mallard) (Anas boschas) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-312) |
| Form : | Lyophilized powder |
| AA Sequence : | MLPAAGLLWWVGALGALYAAVRGALGLLGALRVWGIGAGRAALGPGLGAWAVVTGATDGI GKAYAKELAKRGMKVALISRSKEKLDQVAGEITEQYGVETKVIVADFGEREDIYDRIRAG LEGLEIGVLVNNVGISYSYPEYFIDVPDLDKTIDKMININIMSVCKMTRLVLPGMLERSK GVILNISSAAGMYPTPLLTLYSASKAFVDYFSRGLHAEYKSKGIIVQSVMPYYVATKMSK ISKPSFDKPTPETYVRAAIGTVGLQSQTNGCLPHAFMGWVFSILPTSTVMNLLMKTNKQI RARFLKKKMKEK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | HSD17B12 |
| Synonyms | HSD17B12; SPM2; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12 |
| UniProt ID | O57314 |
| ◆ Recombinant Proteins | ||
| HSD17B12-2579R | Recombinant Rat HSD17B12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSD17B12-7874M | Recombinant Mouse HSD17B12 Protein | +Inquiry |
| Hsd17b12-1411R | Recombinant Rat Hsd17b12 protein, His & GST-tagged | +Inquiry |
| RFL25964RF | Recombinant Full Length Rat Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged | +Inquiry |
| RFL24277HF | Recombinant Full Length Human Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD17B12-818HCL | Recombinant Human HSD17B12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B12 Products
Required fields are marked with *
My Review for All HSD17B12 Products
Required fields are marked with *
