Recombinant Full Length Human Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged

• Cat.No.: RFL24277HF
• Product Overview: Recombinant Full Length Human Estradiol 17-beta-dehydrogenase 12(HSD17B12) Protein (Q53GQ0) (1-312aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Full Length (1-312)
• Form: Lyophilized powder
• AA Sequence: MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTD GIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKT GLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERS KGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLA KIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKS TRAHYLKKTKKN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: HSD17B12
• Synonyms: HSD17B12; SDR12C1; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12; Short chain dehydrogenase/reductase family 12C member 1
• UniProt ID: Q53GQ0