Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 4(Abcg4) Protein, His-Tagged
Cat.No. : | RFL13555AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 4(ABCG4) Protein (Q9SW08) (1-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-577) |
Form : | Lyophilized powder |
AA Sequence : | MESYTLSTSSISYAKPLSPLLLTAEQPSFILRNITLTSHPSQILAIIGPSGAGKSTLLDI LAARTSPTSGSILLNSVLINPSSYRKISSYVPQHDTFFPLLTVSETFTFSASLLLPKNLS KVSSVVASLLKELNLTHLAHTRLGQGLSGGERRRVSIGLSLLHDPEVLLLDEPTSGLDSK SAFDVVQILKSIATSRERIVILSIHQPSFKILSLIDRVLLLSKGTIVYHGRLDLLEAFLL SKGFTVPSQLNSLEYAMEILQNIRDPYENANIALPDHCPESKKQNQKQSIVRYKSSRITE ISLLSSRFWKIIYRTRQLLLTNILESLVVGLVLGTIYLNIGTGKEGIRKRFGLFAFTLTF LLSSTTQTLPIFIDERPILLRETSSGLYRLSSHILANTLVFLPYLLLIAIIYSVSLYFLV GLCFSWQALAYFVLVIWIIVLMANSFVLFLSSLAPNYIAGTSSVTILLAAFFLFSGYFIS KESLPKYWLFMYFFSMYKYALDALLINEYSCLHNKCLVWFEEASVNSCLVTGGDVLDKNG LHERQRWFNVYMLLGFFVLYRVLCFLVLLKRVSGSKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG4 |
Synonyms | ABCG4; WBC4; At4g25750; F14M19.30; ABC transporter G family member 4; ABC transporter ABCG.4; AtABCG4; White-brown complex homolog protein 4; AtWBC4 |
UniProt ID | Q9SW08 |
◆ Recombinant Proteins | ||
ABCG4-0071H | Recombinant Human ABCG4 Protein (Val59-Thr301), N-His-tagged | +Inquiry |
RFL13555AF | Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 4(Abcg4) Protein, His-Tagged | +Inquiry |
ABCG4-797HF | Recombinant Full Length Human ABCG4 Protein, GST-tagged | +Inquiry |
SETD8-2608H | Recombinant Human SETD8 protein, His-tagged | +Inquiry |
ABCG4-068H | Recombinant Human ABCG4 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG4 Products
Required fields are marked with *
My Review for All ABCG4 Products
Required fields are marked with *
0
Inquiry Basket