Recombinant Human SETD8 protein, His-tagged

• Cat.No.: SETD8-2608H
• Product Overview: Recombinant Human SETD8 protein(1-352 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-352 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVRHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Gene Information

• Gene Name: SETD8 SET domain containing (lysine methyltransferase) 8 [ Homo sapiens ]
• Official Symbol: SETD8
• Synonyms: SETD8; SET domain containing (lysine methyltransferase) 8; N-lysine methyltransferase SETD8; KMT5A; PR Set7; SET07; SET8; PR/SET07; H4-K20-HMTase SETD8; lysine N-methyltransferase 5A; SET domain-containing protein 8; PR/SET domain containing protein 8; PR/SET domain-containing protein 07; histone-lysine N-methyltransferase SETD8; H4-K20-specific histone methyltransferase; H4K20-specific histone methyltransferase splice variant Set8b; PR-Set7
• Gene ID: 387893
• mRNA Refseq: NM_020382
• Protein Refseq: NP_065115
• MIM: 607240
• UniProt ID: Q9NQR1