Recombinant Human SETD8 protein, His-tagged

Cat.No. : SETD8-2608H
Product Overview : Recombinant Human SETD8 protein(1-352 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability February 02, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-352 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVRHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Gene Name SETD8 SET domain containing (lysine methyltransferase) 8 [ Homo sapiens ]
Official Symbol SETD8
Synonyms SETD8; SET domain containing (lysine methyltransferase) 8; N-lysine methyltransferase SETD8; KMT5A; PR Set7; SET07; SET8; PR/SET07; H4-K20-HMTase SETD8; lysine N-methyltransferase 5A; SET domain-containing protein 8; PR/SET domain containing protein 8; PR/SET domain-containing protein 07; histone-lysine N-methyltransferase SETD8; H4-K20-specific histone methyltransferase; H4K20-specific histone methyltransferase splice variant Set8b; PR-Set7;
Gene ID 387893
mRNA Refseq NM_020382
Protein Refseq NP_065115
MIM 607240
UniProt ID Q9NQR1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCG4 Products

Required fields are marked with *

My Review for All ABCG4 Products

Required fields are marked with *

0
cart-icon
0
compare icon