Recombinant Full Length Arabidopsis Thaliana Calcium-Activated Outward-Rectifying Potassium Channel 1(Kco1) Protein, His-Tagged
Cat.No. : | RFL30684AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Calcium-activated outward-rectifying potassium channel 1(KCO1) Protein (Q8LBL1) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MSSDAARTPLLPTEKIDTMAQDFNLNSRTSSSRKRRLRRSRSAPRGDCMYNDDVKIDEPP PHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGVVDALYFCIVTM TTVGYGDLVPNSSASRLLACAFVFSGMVLVGHLLSRAADYLVEKQEALLVRAFHLRQSFG PTDILKELHTNKLRYKCYATCLVLVVLFIVGTIFLVMVEKMPVISAFYCVCSTVTTLGYG DKSFNSEAGRLFAVFWILTSSICLAQFFLYVAELNTENKQRALVKWVLTRRITNNDLEAA DLDEDGVVGAAEFIVYKLKEMGKIDEKDISGIMDEFEQLDYDESGTLTTSDIVLAQTTSQ IQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TPK1 |
Synonyms | TPK1; KCO1; At5g55630; MDF20.7; Two-pore potassium channel 1; AtTPK1; Calcium-activated outward-rectifying potassium channel 1; AtKCO1 |
UniProt ID | Q8LBL1 |
◆ Recombinant Proteins | ||
TPK1-17255M | Recombinant Mouse TPK1 Protein | +Inquiry |
TPK1-2241H | Recombinant Human TPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPK1-3611H | Recombinant Human TPK1 protein, GST-tagged | +Inquiry |
TPK1-1583Z | Recombinant Zebrafish TPK1 | +Inquiry |
Tpk1-6597M | Recombinant Mouse Tpk1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPK1-845HCL | Recombinant Human TPK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPK1 Products
Required fields are marked with *
My Review for All TPK1 Products
Required fields are marked with *
0
Inquiry Basket