Recombinant Full Length Arabidopsis Thaliana Hva22-Like Protein D(Hva22D) Protein, His-Tagged

Cat.No. : RFL6890AF
Product Overview : Recombinant Full Length Arabidopsis thaliana HVA22-like protein d(HVA22D) Protein (Q9S760) (1-135aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Arabidopsis thaliana
Source : E.coli
Tag : His
Protein Length : Full Length (1-135)
Form : Lyophilized powder
AA Sequence : MDKFWTFLTALHSGAGPIVMLLYPLYASVIAMESTTKVDDEQWLAYWIIYSFLSLTELIL QSLIEWIPIWYTVKLVFVAWLVLPQFQGAAFIYNRVVREQFKKHGVLRSTHSKPTKPNIL HSIFPHREGHEAHSH
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name HVA22D
Synonyms HVA22D; At4g24960; F13M23.100; HVA22-like protein d; AtHVA22d
UniProt ID Q9S760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HVA22D Products

Required fields are marked with *

My Review for All HVA22D Products

Required fields are marked with *

0
cart-icon
0
compare icon