Recombinant Full Length Atp Synthase Subunit C, Chloroplastic(Atph) Protein, His-Tagged
| Cat.No. : | RFL15646TF |
| Product Overview : | Recombinant Full Length ATP synthase subunit c, chloroplastic(atpH) Protein (Q1KVY0) (1-82aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Tetradesmus obliquus (Green alga) (Acutodesmus obliquus) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-82) |
| Form : | Lyophilized powder |
| AA Sequence : | MNPIVAAASVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | atpH |
| Synonyms | atpH; ATP synthase subunit c, chloroplastic; ATP synthase F(0 sector subunit c; ATPase subunit III; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein |
| UniProt ID | Q1KVY0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All atpH Products
Required fields are marked with *
My Review for All atpH Products
Required fields are marked with *
