Recombinant Full Length Bovine Adp-Ribosylation Factor-Like Protein 6-Interacting Protein 6(Arl6Ip6) Protein, His-Tagged
| Cat.No. : | RFL16354BF |
| Product Overview : | Recombinant Full Length Bovine ADP-ribosylation factor-like protein 6-interacting protein 6(ARL6IP6) Protein (Q3MHM8) (1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-226) |
| Form : | Lyophilized powder |
| AA Sequence : | MSFVESGRRSAPLRRRPGTPVPFARPAYSVFSQGDSWGEGEVEEEEGCDQVARDLRAEFS AGSSSKLRKDPVLQPDGDGSPVLPDKRNGIFSADAGGKALARRWPVQVLSILCSLLFAIL LACLLAITYLIVKELHAENLKNEDDVNTGLLGFWSLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKMTGHSFHMGYSMAILNGIVAALTVAWCLM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ARL6IP6 |
| Synonyms | ARL6IP6; ADP-ribosylation factor-like protein 6-interacting protein 6; ARL-6-interacting protein 6; Aip-6 |
| UniProt ID | Q3MHM8 |
| ◆ Recombinant Proteins | ||
| ARL6IP6-9864H | Recombinant Human ARL6IP6, GST-tagged | +Inquiry |
| RFL16184RF | Recombinant Full Length Rat Adp-Ribosylation Factor-Like Protein 6-Interacting Protein 6(Arl6Ip6) Protein, His-Tagged | +Inquiry |
| ARL6IP6-1941M | Recombinant Mouse ARL6IP6 Protein | +Inquiry |
| ARL6IP6-629H | Recombinant Human ARL6IP6 protein(Met1-Ser110), mFc-tagged | +Inquiry |
| ARL6IP6-405R | Recombinant Rhesus monkey ARL6IP6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL6IP6-8706HCL | Recombinant Human ARL6IP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6IP6 Products
Required fields are marked with *
My Review for All ARL6IP6 Products
Required fields are marked with *
