Recombinant Full Length Bovine Alpha-1A Adrenergic Receptor(Adra1A) Protein, His-Tagged
Cat.No. : | RFL-21264BF |
Product Overview : | Recombinant Full Length Bovine Alpha-1A adrenergic receptor(ADRA1A) Protein (P18130) (1-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-466) |
Form : | Lyophilized powder |
AA Sequence : | MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADRA1A |
Synonyms | ADRA1A; ADRA1C; Alpha-1A adrenergic receptor; Alpha-1A adrenoreceptor; Alpha-1A adrenoceptor; Alpha-1C adrenergic receptor |
UniProt ID | P18130 |
◆ Recombinant Proteins | ||
ADRA1A-86R | Recombinant Rhesus Macaque ADRA1A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-18418CF | Recombinant Full Length Dog Alpha-1A Adrenergic Receptor(Adra1A) Protein, His-Tagged | +Inquiry |
ADRA1A-0570H | Recombinant Human ADRA1A Protein (Ser330-Val466), N-His-tagged | +Inquiry |
ADRA1A-6778H | Recombinant Human ADRA1A protein, His & T7-tagged | +Inquiry |
ADRa1A-3224H | Recombinant Human ADRa1A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADRA1A Products
Required fields are marked with *
My Review for All ADRA1A Products
Required fields are marked with *
0
Inquiry Basket