Recombinant Full Length Bovine Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged
Cat.No. : | RFL-10844BF |
Product Overview : | Recombinant Full Length Bovine Apoptosis-inducing factor 2(AIFM2) Protein (A5PJM4) (2-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-373) |
Form : | Lyophilized powder |
AA Sequence : | GSQVSMDAGAVHVVIVGGGFGGIAAASQLQALNIPFVLVDMKDSFHHNVAALRASVESGFAKKTFISYSVTFKENFRQGLVVEIDLKNQTVLLEDGQALPFSHLILATGSTGLFPGKFNQVSSQQMAIQAYEDMVTQVQRSQSIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSKMALADTELLPCVRQEVKEILLRKGVQLLLSERVSNLEALPVNERRECIKVQTDKGTEVDANLVIVCNGIKINSAAYRSAFGDRLASNGALRVNEYLQVEGYSHIYAIGDCADVREPKMAYHASLHANVAVANIVNSMKQRPLKTYKPGSLTFLLAMGRNDGVGQISGFYVGRLMVRLAKSRDLLVSTSWKTMKQSPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIFM2 |
Synonyms | AIFM2; Ferroptosis suppressor protein 1; FSP1; Apoptosis-inducing factor homologous mitochondrion-associated inducer of death; AMID; p53-responsive gene 3 protein |
UniProt ID | A5PJM4 |
◆ Recombinant Proteins | ||
AIFM2-412M | Recombinant Mouse AIFM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIFM2-7901Z | Recombinant Zebrafish AIFM2 | +Inquiry |
AIFM2-956HF | Recombinant Full Length Human AIFM2 Protein, GST-tagged | +Inquiry |
RFL-12462TF | Recombinant Full Length Taeniopygia Guttata Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
AIFM2-9504H | Recombinant Human AIFM2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIFM2 Products
Required fields are marked with *
My Review for All AIFM2 Products
Required fields are marked with *
0
Inquiry Basket