Recombinant Full Length Bovine B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain(Cd79A) Protein, His-Tagged
Cat.No. : | RFL30044BF |
Product Overview : | Recombinant Full Length Bovine B-cell antigen receptor complex-associated protein alpha chain(CD79A) Protein (P40293) (32-223aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (32-223) |
Form : | Lyophilized powder |
AA Sequence : | LWVEWGPPSVTVSVGEEVRLQCTHNGSNTNVTWWHVLQSNSSWPPVMYRGDVGAGGELIIKPVNKTHRGMYRCQVSDGKKIQRSCGTYLRVRDPLPRPFLDMGEGTKNNIITAEGIILLICAVVPGTLLLFRKRWQNMKFGADIQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDAQLEKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD79A |
Synonyms | CD79A; IGA; MB-1; B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a |
UniProt ID | P40293 |
◆ Recombinant Proteins | ||
CD79A-327H | Recombinant Human CD79A Protein, Fc-tagged | +Inquiry |
RFL29738MF | Recombinant Full Length Mouse B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain(Cd79A) Protein, His-Tagged | +Inquiry |
CD79A-0856H | Recombinant Human CD79A Protein, His-Flag-StrepII-Tagged | +Inquiry |
CD79A-27509TH | Recombinant Human CD79A | +Inquiry |
Cd79a-904MAF555 | Recombinant Mouse Cd79a Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79A Products
Required fields are marked with *
My Review for All CD79A Products
Required fields are marked with *