Recombinant Full Length Bovine Brain Protein 44-Like Protein(Brp44L) Protein, His-Tagged
| Cat.No. : | RFL22916BF |
| Product Overview : | Recombinant Full Length Bovine Brain protein 44-like protein(BRP44L) Protein (Q3ZCG2) (2-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-109) |
| Form : | Lyophilized powder |
| AA Sequence : | AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIRHEMSKKASA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MPC1 |
| Synonyms | MPC1; BRP44L; Mitochondrial pyruvate carrier 1; Brain protein 44-like protein |
| UniProt ID | Q3ZCG2 |
| ◆ Recombinant Proteins | ||
| MPC1-1250H | Recombinant Human MPC1 protein, MYC/DDK-tagged | +Inquiry |
| MPC1-3197HFL | Recombinant Full Length Human MPC1 protein, Flag-tagged | +Inquiry |
| MPC1-3168C | Recombinant Chicken MPC1 | +Inquiry |
| MPC1-5643M | Recombinant Mouse MPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MPC1-535Z | Recombinant Zebrafish MPC1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPC1-8404HCL | Recombinant Human BRP44L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPC1 Products
Required fields are marked with *
My Review for All MPC1 Products
Required fields are marked with *



