Recombinant Full Length Bovine Ceramide Synthase 2(Cers2) Protein, His-Tagged
Cat.No. : | RFL13608BF |
Product Overview : | Recombinant Full Length Bovine Ceramide synthase 2(CERS2) Protein (Q3ZBF8) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MLQTLHDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERSDREETESSEGEEAAAGGGA KNRPLANGHPILNNNHRKND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CERS2 |
Synonyms | CERS2; LASS2; Ceramide synthase 2; CerS2; LAG1 longevity assurance homolog 2; Sphingosine N-acyltransferase CERS2; Tumor metastasis-suppressor gene 1 protein; Very-long-chain ceramide synthase CERS2 |
UniProt ID | Q3ZBF8 |
◆ Recombinant Proteins | ||
RFL586HF | Recombinant Full Length Human Ceramide Synthase 2(Cers2) Protein, His-Tagged | +Inquiry |
RFL13608BF | Recombinant Full Length Bovine Ceramide Synthase 2(Cers2) Protein, His-Tagged | +Inquiry |
Cers2-2121M | Recombinant Mouse Cers2 Protein, Myc/DDK-tagged | +Inquiry |
CERS2-820H | Recombinant Human CERS2 | +Inquiry |
CERS2-1295HFL | Recombinant Full Length Human CERS2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CERS2-4819HCL | Recombinant Human LASS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CERS2 Products
Required fields are marked with *
My Review for All CERS2 Products
Required fields are marked with *