Recombinant Full Length Bovine Chloride Intracellular Channel Protein 4(Clic4) Protein, His-Tagged
Cat.No. : | RFL19545BF |
Product Overview : | Recombinant Full Length Bovine Chloride intracellular channel protein 4(CLIC4) Protein (Q9XSA7) (2-253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-253) |
Form : | Lyophilized powder |
AA Sequence : | ALSMPLNGLKEEDKEPIIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKR KPADLQNLAPGTHPPFITFNNEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDI FAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDG NEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVE IAYSDVAKRLTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLIC4 |
Synonyms | CLIC4; Chloride intracellular channel protein 4; Intracellular chloride ion channel protein p64H1 |
UniProt ID | Q9XSA7 |
◆ Recombinant Proteins | ||
CLIC4-799H | Recombinant Human CLIC4 Protein, His&GST-tagged | +Inquiry |
CLIC4-1108R | Recombinant Rat CLIC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLIC4-1647HFL | Recombinant Full Length Human CLIC4 Protein, C-Flag-tagged | +Inquiry |
CLIC4-735R | Recombinant Rhesus Macaque CLIC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLIC4-3095H | Recombinant Human CLIC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC4-7446HCL | Recombinant Human CLIC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC4 Products
Required fields are marked with *
My Review for All CLIC4 Products
Required fields are marked with *