Recombinant Full Length Bovine Claudin-18(Cldn18) Protein, His-Tagged
Cat.No. : | RFL6940BF |
Product Overview : | Recombinant Full Length Bovine Claudin-18(CLDN18) Protein (Q0VCN0) (1-261aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-261) |
Form : | Lyophilized powder |
AA Sequence : | MSTTRCQVVGFLLSILGLAGCIVATEMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYLTILGLPAMLQAVRALMIVGIVLSVIGLLVAIFALKCIRMGNMDDSAKAKMTLT SGIMFIIAGLCAIAGVSVFANMLVTNFWMSTASMFTSMGGMVQTVQTRYTFGAALFVGWV AGGLTLIGGVLMCIACRGLAPEETNYKAVSYHASGHNVAYRPGGFKASSGFESNTRNKKI YDGGARTEDEGQSPPSKYDYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDN18 |
Synonyms | CLDN18; Claudin-18 |
UniProt ID | Q0VCN0 |
◆ Recombinant Proteins | ||
CLDN18-056H | Recombinant Human CLDN18 protein, GFP-tagged(VLPs) | +Inquiry |
CLDN18-857H | Active Recombinant Human CLDN18 protein | +Inquiry |
CLDN18-835H | Active Recombinant Human CLDN18 protein, His-Twin-Strep-tagged(Nanodisc) | +Inquiry |
Cldn18-35M | Recombinant Mouse Cldn18 protein, His/SUMO-tagged | +Inquiry |
CLDN18-835M | Active Recombinant Mouse CLDN18 protein, His-Twin-Strep-tagged(Detergent) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN18 Products
Required fields are marked with *
My Review for All CLDN18 Products
Required fields are marked with *
0
Inquiry Basket