Recombinant Full Length Bovine Dolichol Phosphate-Mannose Biosynthesis Regulatory Protein(Dpm2) Protein, His-Tagged
Cat.No. : | RFL18043BF |
Product Overview : | Recombinant Full Length Bovine Dolichol phosphate-mannose biosynthesis regulatory protein(DPM2) Protein (Q2KIN1) (2-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-84) |
Form : | Lyophilized powder |
AA Sequence : | ATGTDQVVGLGLVALSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAIAIPLAAGHLL LLFVGIFITYVMLKNQNDTKKTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DPM2 |
Synonyms | DPM2; Dolichol phosphate-mannose biosynthesis regulatory protein; Dolichol-phosphate mannose synthase subunit 2; DPM synthase subunit 2 |
UniProt ID | Q2KIN1 |
◆ Recombinant Proteins | ||
DPM2-2815H | Recombinant Human DPM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPM2-1146R | Recombinant Rhesus Macaque DPM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7766HF | Recombinant Full Length Human Dolichol Phosphate-Mannose Biosynthesis Regulatory Protein(Dpm2) Protein, His-Tagged | +Inquiry |
DPM2-652H | Recombinant Human DPM2 | +Inquiry |
DPM2-6600Z | Recombinant Zebrafish DPM2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPM2-6834HCL | Recombinant Human DPM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPM2 Products
Required fields are marked with *
My Review for All DPM2 Products
Required fields are marked with *