Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase March3(March3) Protein, His-Tagged
Cat.No. : | RFL30887BF |
Product Overview : | Recombinant Full Length Bovine E3 ubiquitin-protein ligase MARCH3(MARCH3) Protein (A0JN69) (1-253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-253) |
Form : | Lyophilized powder |
AA Sequence : | MTTSRCSHLPEVLPDCTGSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLIPKSVNIPSNQQSLLG LHSAKRNSKETIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MARCH3 |
Synonyms | MARCHF3; MARCH3; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING-type E3 ubiquitin transferase MARCHF3 |
UniProt ID | A0JN69 |
◆ Recombinant Proteins | ||
MARCH3-3585R | Recombinant Rat MARCH3 Protein | +Inquiry |
RFL28394XF | Recombinant Full Length Xenopus Tropicalis E3 Ubiquitin-Protein Ligase March3(41336) Protein, His-Tagged | +Inquiry |
MARCH3-2499R | Recombinant Rhesus Macaque MARCH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCH3-2679R | Recombinant Rhesus monkey MARCH3 Protein, His-tagged | +Inquiry |
MARCH3-3241R | Recombinant Rat MARCH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH3-4471HCL | Recombinant Human MARCH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MARCH3 Products
Required fields are marked with *
My Review for All MARCH3 Products
Required fields are marked with *
0
Inquiry Basket