Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged
| Cat.No. : | RFL32071BF |
| Product Overview : | Recombinant Full Length Bovine E3 ubiquitin-protein ligase MARCH8(41341) Protein (Q0VD59) (1-289aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-289) |
| Form : | Lyophilized powder |
| AA Sequence : | MNMPLHQISAIPSQDATSARVYRSKTKEKEREEQNEKTLGHSMSHSSNISKAGGSSVASA PVSSFPRTSVTPSNQDICRICHCEGDDESPLITPCRCTGSLHFVHQTCLQQWIKSSDTRC CELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAE EIRQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWRRLKAYNRVIYVQNCP ETSKRNIFEKPALPEPNFESKDGRGVCHSDTNSSCCTEPEDTGAEIIHV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MARCH8 |
| Synonyms | MARCHF8; MARCH8; E3 ubiquitin-protein ligase MARCHF8; Membrane-associated RING finger protein 8; Membrane-associated RING-CH protein VIII; MARCH-VIII; RING-type E3 ubiquitin transferase MARCHF8 |
| UniProt ID | Q0VD59 |
| ◆ Recombinant Proteins | ||
| MARCH8-5368M | Recombinant Mouse MARCH8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MARCH8-748H | Recombinant Human 41341, GST-tagged | +Inquiry |
| RFL11909XF | Recombinant Full Length Xenopus Laevis E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged | +Inquiry |
| MARCH8-6246Z | Recombinant Zebrafish MARCH8 | +Inquiry |
| MARCH8-3221H | Recombinant Human MARCH8 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MARCH8-4468HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
| MARCH8-4467HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
| MARCH8-4469HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARCH8 Products
Required fields are marked with *
My Review for All MARCH8 Products
Required fields are marked with *
