Recombinant Full Length Xenopus Tropicalis E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged
Cat.No. : | RFL33341XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis E3 ubiquitin-protein ligase MARCH8(41341) Protein (Q28IK8) (1-264aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-264) |
Form : | Lyophilized powder |
AA Sequence : | MHSCWKMKLQNEKTLGHSVSRSSNISKAGSPTSVSAPSSFPRTSVTPSSQDICRICHCEG DDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPLRKWEKLQM TASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKMGQNNGILEWPFWTKLVVVAIG FTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETCKKKIFEKSVIIEPNLESKEALG IHHSDTNSSYYTEPEDCGAAILQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | march8 |
Synonyms | marchf8; march8; TNeu072c23.1; E3 ubiquitin-protein ligase MARCHF8; Membrane-associated RING finger protein 8; Membrane-associated RING-CH protein VIII; MARCH-VIII; RING-type E3 ubiquitin transferase MARCHF8 |
UniProt ID | Q28IK8 |
◆ Recombinant Proteins | ||
RFL11909XF | Recombinant Full Length Xenopus Laevis E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged | +Inquiry |
MARCH8-6246Z | Recombinant Zebrafish MARCH8 | +Inquiry |
MARCH8-5368M | Recombinant Mouse MARCH8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33341XF | Recombinant Full Length Xenopus Tropicalis E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged | +Inquiry |
MARCH8-748H | Recombinant Human 41341, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH8-4468HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
MARCH8-4469HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
MARCH8-4467HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All march8 Products
Required fields are marked with *
My Review for All march8 Products
Required fields are marked with *