Recombinant Full Length Bovine Ectonucleoside Triphosphate Diphosphohydrolase 5(Entpd5) Protein, His-Tagged
Cat.No. : | RFL13763BF |
Product Overview : | Recombinant Full Length Bovine Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5) Protein (E1BPW0) (1-432aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-432) |
Form : | Lyophilized powder |
AA Sequence : | MALYQGAAFFMLVASCVCSTVFHREQQTWFEGVFLSSMCPVNVSAGTLYGIMFDAGSTGTRIHVYTFVQKVPDNTGQLPVLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPPSHWKRTPVVLKATAGLRLLPEEKAEALLFEVKEIFKKSPFLVPDDSVSIMDGSYEGILAWVTVNFLTGQLHGHNQETVGTLDLGGASTQITFLPQFEKTLEQTPRDYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETAGIDGYTFRSACLPRWLEAEWIFGGVKYQYGGNQEAGEVGFEPCYAEVLRVVQGKLHQPDEVQRGSFYAFSYYYDRAVDTDMIDYEKGGVLKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFASSTVLQLTKKVNNIETGWALGATFHLLQSLGISH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ENTPD5 |
Synonyms | ENTPD5; Ectonucleoside triphosphate diphosphohydrolase 5; NTPDase 5; Guanosine-diphosphatase ENTPD5; GDPase ENTPD5; Uridine-diphosphatase ENTPD5; UDPase ENTPD5 |
UniProt ID | E1BPW0 |
◆ Recombinant Proteins | ||
ENTPD5-551M | Recombinant Mouse Entpd5, His tagged | +Inquiry |
ENTPD5-4334HF | Recombinant Full Length Human ENTPD5 Protein, GST-tagged | +Inquiry |
RFL947HF | Recombinant Full Length Human Ectonucleoside Triphosphate Diphosphohydrolase 5(Entpd5) Protein, His-Tagged | +Inquiry |
ENTPD5-1034H | Active Recombinant Human ENTPD5 Protein, His-tagged | +Inquiry |
ENTPD5-2111R | Recombinant Rat ENTPD5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD5-001MCL | Recombinant Mouse ENTPD5 cell lysate | +Inquiry |
ENTPD5-451HCL | Recombinant Human ENTPD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENTPD5 Products
Required fields are marked with *
My Review for All ENTPD5 Products
Required fields are marked with *